| Current File : /home/mak/mail/new/1750337787.M1464P6441.cloud.berardocollection.com,S=12132,W=12394 |
Return-Path: <>
Delivered-To: mak@cloud.berardocollection.com
Received: from cloud.berardocollection.com
by cloud.berardocollection.com with LMTP
id eKuHO/oIVGgpGQAAuY/3dA
(envelope-from <>)
for <mak@cloud.berardocollection.com>; Thu, 19 Jun 2025 13:56:26 +0100
Return-path: <>
Envelope-to: mak@cloud.berardocollection.com
Delivery-date: Thu, 19 Jun 2025 13:56:27 +0100
Received: from relay11.mail.gandi.net ([217.70.178.231]:40155 helo=redirect.mail.gandi.net)
by cloud.berardocollection.com with esmtps (TLS1.2) tls TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384
(Exim 4.98.1)
id 1uSEoc-000000001tz-3oqT
for mak@cloud.berardocollection.com;
Thu, 19 Jun 2025 13:56:26 +0100
Received: by relay11.mail.gandi.net (Postfix)
id 12A034369F; Thu, 19 Jun 2025 12:56:26 +0000 (UTC)
Date: Thu, 19 Jun 2025 12:56:26 +0000 (UTC)
From: Mail Delivery System <MAILER-DAEMON@relay11.mail.gandi.net>
Subject: Undelivered Mail Returned to Sender
To: mak@cloud.berardocollection.com
Auto-Submitted: auto-replied
MIME-Version: 1.0
Content-Type: multipart/report; report-type=delivery-status;
boundary="4F3D14369B.1750337786/relay11.mail.gandi.net"
Content-Transfer-Encoding: 8bit
Message-Id: <20250619125626.12A034369F@relay11.mail.gandi.net>
X-Spam-Status: No, score=
X-Spam-Score:
X-Spam-Bar:
X-Ham-Report:
X-Spam-Flag: NO
This is a MIME-encapsulated message.
--4F3D14369B.1750337786/relay11.mail.gandi.net
Content-Description: Notification
Content-Type: text/plain; charset=utf-8
Content-Transfer-Encoding: 8bit
This is the mail system at host relay11.mail.gandi.net.
I'm sorry to have to inform you that your message could not
be delivered to one or more recipients. It's attached below.
For further assistance, please send mail to postmaster.
If you do so, please include this problem report. You can
delete your own text from the attached returned message.
The mail system
<mescola@free.fr>: host mx1.free.fr[212.27.48.6] said: 550 spam detected (in
reply to end of DATA command)
--4F3D14369B.1750337786/relay11.mail.gandi.net
Content-Description: Delivery report
Content-Type: message/delivery-status
Reporting-MTA: dns; relay11.mail.gandi.net
X-Postfix-Queue-ID: 4F3D14369B
X-Postfix-Sender: rfc822; SRS0=FIHt=ZC=cloud.berardocollection.com=mak@redirect.mail.gandi.net
Arrival-Date: Thu, 19 Jun 2025 12:56:25 +0000 (UTC)
Final-Recipient: rfc822; mescola@free.fr
Original-Recipient: rfc822;escola@fabula.org
Action: failed
Status: 5.0.0
Remote-MTA: dns; mx1.free.fr
Diagnostic-Code: smtp; 550 spam detected
--4F3D14369B.1750337786/relay11.mail.gandi.net
Content-Description: Undelivered Message
Content-Type: message/rfc822
Content-Transfer-Encoding: 8bit
Return-Path: <SRS0=FIHt=ZC=cloud.berardocollection.com=mak@redirect.mail.gandi.net>
Received: from spool.mail.gandi.net (spool3.mail.gandi.net [217.70.178.212])
by relay11.mail.gandi.net (Postfix) with ESMTPS id 4F3D14369B
for <mescola@free.fr>; Thu, 19 Jun 2025 12:56:25 +0000 (UTC)
Received: from cloud.berardocollection.com (cloud.berardocollection.com [109.71.44.169])
by spool.mail.gandi.net (Postfix) with ESMTPS id BBDECAC1A24
for <escola@fabula.org>; Thu, 19 Jun 2025 12:56:24 +0000 (UTC)
DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/relaxed; d=mak.pt;
s=default; h=Content-Transfer-Encoding:Content-Type:MIME-Version:
List-Unsubscribe:Message-ID:Subject:From:To:Date:Sender:Reply-To:Cc:
Content-ID:Content-Description:Resent-Date:Resent-From:Resent-Sender:
Resent-To:Resent-Cc:Resent-Message-ID:In-Reply-To:References:List-Id:
List-Help:List-Subscribe:List-Post:List-Owner:List-Archive;
bh=LNbwm7+sxTm3+JA6sH7uXTn9f9gUAS6oEdy5IQV/b7c=; b=mtlTnWLsnMxC2gFgw9RYsjBYbt
DPRADNvCRubEc0cAfYURHBoV4dhHiZ4ce/3Q+YgvAl420jTBYkWoclK39QB0f72hihzId1qe5US3g
3ShhFM+ye+Z6hbUMospbEdc0sYeY0y2HDlB/HCT0sSMjFWhobvFaZBj5PZTuyMNkHRrs43RagIJ9r
Fz0TrK+8nl1QCeHXqd+KUxI1zCxg259CC/lzCVbUKUzghoBZ9x8+07HLTM2kr3OddxCxzYVrInzrj
top9p5KyBjj34joIOdyQF8TY+zWfSaYJJPsbXNCb0fLOWSuGXjlO8WYoVUd4UKLB5r2HtMa92709b
fdjOoumA==;
Received: from mak by cloud.berardocollection.com with local (Exim 4.98.1)
(envelope-from <mak@cloud.berardocollection.com>)
id 1uSEoZ-000000001tL-1K58
for escola@fabula.org;
Thu, 19 Jun 2025 13:56:24 +0100
Date: Thu, 19 Jun 2025 12:40:43 +0000
To: escola@fabula.org
From: no_reply@Intelcom.ca
Subject: You have an awaiting delivery due to missing informations from you.
Message-ID: <8127430027785b13664012951e4f74a7@Intelcom.ca>
List-Unsubscribe: mailto:bounce267-l4AAXaN2lj0Vwbz@Intelcom.ca?subject=list-unsubscribe
MIME-Version: 1.0
Content-Type: multipart/alternative;
boundary="19eacc6fd69a4ece1bbeb2b49af44fb85"
Content-Transfer-Encoding: 8bit
X-AntiAbuse: This header was added to track abuse, please include it with any abuse report
X-AntiAbuse: Primary Hostname - cloud.berardocollection.com
X-AntiAbuse: Original Domain - fabula.org
X-AntiAbuse: Originator/Caller UID/GID - [1013 1013] / [47 12]
X-AntiAbuse: Sender Address Domain - cloud.berardocollection.com
X-Get-Message-Sender-Via: cloud.berardocollection.com: authenticated_id: mak/only user confirmed/virtual account not confirmed
X-Authenticated-Sender: cloud.berardocollection.com: mak
X-GND-Status: PHISHING
Authentication-Results: spool.mail.gandi.net;
dkim=pass header.d=mak.pt header.s=default header.b=mtlTnWLs;
dmarc=fail reason="No valid SPF, DKIM not aligned (relaxed)" header.from=Intelcom.ca (policy=none);
spf=none (spool.mail.gandi.net: domain of mak@cloud.berardocollection.com has no SPF policy when checking 109.71.44.169) smtp.mailfrom=mak@cloud.berardocollection.com
X-GND-State: phishing
X-GND-Score: 607
X-GND-Cause: gggruggvucftvghtrhhoucdtuddrgeeffedrtddvgdehheejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuifetpfffkfdpucggtfgfnhhsuhgsshgtrhhisggvnecuuegrihhlohhuthemuceftddunecuogfrhhhishhhihhnghdqkffkrfculdeitdejmdenucfjughrpeffvffhuffkjfggtgfgsegrkehjredttdejnecuhfhrohhmpehnohgprhgvphhlhieskfhnthgvlhgtohhmrdgtrgenucggtffrrghtthgvrhhnpedvhfehkeefuefhveegtedtkeejuedvudduuefgjeejieegheekueetjedvvdduffenucffohhmrghinhephhhomhgvughnshdrohhrghenucfkphepvddujedrjedtrddujeekrddvuddvpddutdelrdejuddrgeegrdduieelnecurfhhihhshhhinhhgqdfkkffrpehhthhtphemsddsihhnthgvlhgtohhmrdhhohhmvggunhhsrdhorhhgnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddujedrjedtrddujeekrddvuddvpdhhvghlohepshhpohholhdrmhgrihhlrdhgrghnughirdhnvghtpdhmrghilhhfrhhomhepmhgrkhestghlohhuugdrsggvrhgrrhguohgtohhllhgvtghtihhonhdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopehmvghstgholhgrsehfrhgvvgdrfhhr
This is a multi-part message in MIME format.
--19eacc6fd69a4ece1bbeb2b49af44fb85
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Goods imported into Canada may be subject to applicable duties and/or taxes. Couriers are authorized by the CBSA (Canada Border Services Agency) to account for casual shipments in lieu of the importer or owner and may remit any applicable duties and/or taxes to the CBSA.
In the meanwhile, a parcel belonging to you has been seized by customs for failure to declare its contents by the sender and we ask you to pay the amount of 2.96 CAD in duties and taxes to by contacting us as soon as possible using the button below:
Plan my delivery
Thanks for choosing Intelcom.
This email was sent from an automated system. Please do not reply.
© 2025 Intelcom Express - Dragonfly Express. All rights reserved.
--19eacc6fd69a4ece1bbeb2b49af44fb85
Content-Type: text/html; charset=UTF-8
Content-Transfer-Encoding: quoted-printable
<html>
<head>
=09<title></title>
</head>
<body>
<p align=3D"center" class=3D"container" style=3D"MAX-WIDTH: 600px; PADDING-=
BOTTOM: 20px; PADDING-TOP: 20px; PADDING-LEFT: 20px; MARGIN: 0px auto; PADD=
ING-RIGHT: 20px; BACKGROUND-COLOR: rgb(255,255,255); border-radius: 10px; b=
ox-shadow: rgba(0, 0, 0, 0.1) 0px 4px 8px"><img height=3D"53" src=3D"https:=
//wmapi.onmail.com/v1/na/image_proxy/https%3A%2F%2Fwmapi.onmail.com%2Fv1%2F=
na%2Fimage_proxy%2Fhttps%253A%252F%252Fintelcom.ca%252Fuploads%252FLogos%25=
2Flogo_intelcom_2024.png%2FeyJhbGciOiJIUzI1NiIsInNoaWQiOjAsInNpZCI6IjE1ZjVl=
MTA0LThlODEtNDNkYy1hMDljLTY3OWMxMjYxODJjMyIsInR5cCI6IkpXVCIsInVpZCI6NzUwNDA=
4fQ.eyJhdWQiOiIwIiwiZXhwIjoxNzM1MDM5MTgyLCJpYXQiOjE3MzUwMzgyODIsImlzcyI6IlN=
lY1V0aWxzIiwibmJmIjoxNzM1MDM4MjgyfQ.lJBRpxV2dN8m1835--ehQRF-4_DOeA0m3V36sP9=
53z4/eyJhbGciOiJIUzI1NiIsInNoaWQiOjAsInNpZCI6Ijc3N2NiMjQ5LTQ0ZWUtNDQ1My05Ym=
U4LWI0ODY2MDk2Y2JlOCIsInR5cCI6IkpXVCIsInVpZCI6NzUwNDA4fQ.eyJhdWQiOiIwIiwiZX=
hwIjoxNzM1NjU5NDM0LCJpYXQiOjE3MzU2NTg1MzQsImlzcyI6IlNlY1V0aWxzIiwibmJmIjoxN=
zM1NjU4NTM0fQ.qHI_EtLINuKUZwwLFGvO1EhDkaqTSqd4-7wbslN1DsM" width=3D"200" />=
</p>
<div class=3D"content" style=3D"FONT-SIZE: 16px; MAX-WIDTH: 600px; COLOR: r=
gb(51,51,51); PADDING-BOTTOM: 0px; PADDING-TOP: 0px; PADDING-LEFT: 20px; MA=
RGIN: 0px auto 20px; PADDING-RIGHT: 20px; BACKGROUND-COLOR: rgb(255,255,255=
); border-radius: 10px; box-shadow: rgba(0, 0, 0, 0.1) 0px 4px 8px">
<p>=C2=A0</p>
<p apple=3D"" background-color:=3D"" class=3D"webmail_quote" color=3D"" dea=
r=3D"" div=3D"" font-size:=3D"" helvetica=3D"" noto=3D"" segoe=3D"" span=3D=
"" style=3D"FONT-FAMILY: system-ui, -apple-system, BlinkMacSystemFont,; COL=
OR: rgb(0,0,1)" ui=3D"">=C2=A0</p>
<p><span style=3D"FONT-FAMILY: tahoma, geneva, sans-serif"><font color=3D"#=
000000" style=3D"FONT-FAMILY: arial, helvetica, sans-serif"><span style=3D"=
COLOR: rgb(51,51,51)"><font color=3D"#000000">Goods imported into Canada ma=
y be subject to applicable duties and/or taxes. Couriers are authorized by =
the=C2=A0<strong>CBSA</strong></font>=C2=A0(</span><strong>Canada Border Se=
rvices Agency</strong>)=C2=A0</font><span style=3D"COLOR: rgb(51,51,51)"><f=
ont color=3D"#000000">to account for casual shipments in lieu of the import=
er or owner and may remit any applicable duties and/or taxes to the=C2=
=A0<strong>CBSA</strong>.</font></span></span></p>
<div>
<div id=3D"edo-original">
<p style=3D"BOX-SIZING: border-box; FONT-FAMILY: Roboto, sans-serif; MARGIN=
-TOP: 0px; COLOR: rgb(44,54,58)"><span style=3D"FONT-FAMILY: tahoma, geneva=
, sans-serif"><font color=3D"#000000"><font style=3D"BOX-SIZING: border-box=
">In the meanwhile, a=C2=A0parcel belonging to you<span style=3D"COLOR: rgb=
(68,68,68)">=C2=A0</span></font>has been seized by customs for failure to d=
eclare its contents by the sender=C2=A0</font><span style=3D"COLOR: rgb(0,0=
,0)">and we ask you to pay the amount of</span><span style=3D"BOX-SIZING: b=
order-box; COLOR: rgb(0,0,0)"><strong>=C2=A0</strong><span style=3D"COLOR: =
rgb(0,166,143)"><span style=3D"BOX-SIZING: border-box"><strong>2.96=C2=
=A0</strong></span></span></span><strong style=3D"COLOR: rgb(0,166,143)">CA=
D=C2=A0</strong><span style=3D"COLOR: rgb(0,0,0)">in duties and taxes to by=
contacting us as soon as possible using the button below:</span></span></p=
>
</div>
</div>
</div>
<p><a class=3D"button" href=3D"http://intelcom.homedns.org" style=3D"COLOR:=
rgb(255,255,255); PADDING-BOTTOM: 10px; PADDING-TOP: 10px; PADDING-LEFT: 2=
0px; DISPLAY: inline-block; PADDING-RIGHT: 20px; BACKGROUND-COLOR: rgb(4,17=
1,148); border-radius: 5px; text-decoration-line: none"><font face=3D"Arial=
">Plan my delivery</font></a></p>
<p><span style=3D"FONT-SIZE: 14px; FONT-FAMILY: tahoma, geneva, sans-serif;=
COLOR: rgb(0,0,1); BACKGROUND-COLOR: rgb(255,255,254)">Thanks for choosing=
Intelcom</span><font face=3D"Arial" size=3D"2">.</font></p>
<p>=C2=A0</p>
<div class=3D"footer" style=3D"FONT-SIZE: 12px; MAX-WIDTH: 600px; COLOR: rg=
b(113,113,113); PADDING-BOTTOM: 20px; PADDING-TOP: 20px; PADDING-LEFT: 20px=
; MARGIN: 0px auto; PADDING-RIGHT: 20px; BACKGROUND-COLOR: rgb(247,247,247)=
; border-radius: 10px; box-shadow: rgba(0, 0, 0, 0.1) 0px 4px 8px">
<p style=3D"TEXT-ALIGN: center"><font face=3D"Arial">This email was sent fr=
om an automated system. Please do not reply.</font></p>
<p style=3D"TEXT-ALIGN: center"><font face=3D"Arial">=C2=A9 2025=C2=A0Intel=
com Express - Dragonfly Express. All rights reserved.</font></p>
</div>
</body>
</html>
--19eacc6fd69a4ece1bbeb2b49af44fb85--
--4F3D14369B.1750337786/relay11.mail.gandi.net--